PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G13840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 303aa    MW: 33134.3 Da    PI: 6.4412
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G13840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.26.5e-271567254
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                     +rlrWt +LHerFv av++LGG+++AtPk++l++m v+gLtl+h+kSHLQ  R
  OPUNC08G13840.1 15 TRLRWTGQLHERFVLAVSELGGADRATPKSVLRAMAVPGLTLYHLKSHLQVRR 67
                     7*************************************************766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-251368IPR009057Homeodomain-like
SuperFamilySSF466891.16E-121368IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-191567IPR006447Myb domain, plants
PfamPF143797.2E-15154194IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSSQQYAGEA AAARTRLRWT GQLHERFVLA VSELGGADRA TPKSVLRAMA VPGLTLYHLK  60
SHLQVRRALR QPISFSQTSA SVLVSDSKYR QAVSRGGNGG GGLKDRSSSS DRQPADHDGD  120
SAVDESHTIA YDGDGDSDGD DAKEALRDSS RSMVQMQREV QRKLQEQIEV QRHLQLRMEA  180
QGRYLQSVLR RAQQVLADHS LASSPELSEL ASAVEIECMS SSSPPRHHRQ SAATDSCVTT  240
SSSEAESKAA GSKRLHTSDC TVEQPVQGKR AFNFLQRHNQ AEQEEEEYAG AEDGSSSEID  300
LNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0703380.0AK070338.1 Oryza sativa Japonica Group cDNA clone:J023049D17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650853.11e-149PREDICTED: myb family transcription factor APL
TrEMBLA0A0E0LV670.0A0A0E0LV67_ORYPU; Uncharacterized protein
STRINGORGLA08G0138500.11e-158(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.17e-39G2-like family protein